Peptides & HGH

Des (1-3) IGF 1 mg Bio-Peptide

Bio Peptide

95,00

In Stock (100 available)

Des (1-3) IGF 1 mg Bio-Peptide (1 mg) — Bio-Peptide presents this pharmaceutical-grade compound — a modified version of IGF-1 with an extended half-life that directly s…

100 in stock

This product is for laboratory research use only. Not for human consumption.

5+ −10%
10+ −15% Best price
Third-Party Lab Report HPLC verified
CoA available on request — email support@vitalquests.org with the batch code from your vial.
HPLC TestedBatch report available
No Labels on BoxPlain brown parcel
Pay the CourierCash on delivery only
Ships TodayOrder before 14:00
€85+ = free shipping
EU warehouse — no customs, no delays
Tracked via DHL / DPD / InPost

Description

Des (1-3) IGF 1 mg Bio-Peptide — IGF-1 from Bio-Peptide at 1 mg. The primary downstream mediator of growth hormone action — drives muscle-cell proliferation (true hyperplasia), amino-acid uptake, and fatty-acid oxidation.

Key Benefits

  • Long-R3 IGF-1 analogue — extended half-life via Arg3 substitution
  • Direct IGF-1 receptor activation for satellite-cell recruitment
  • Bypass hepatic IGF-1 production for targeted muscle effect
  • Subcutaneous or site-injection protocols
  • Stacks with GH-axis compounds (HGH, CJC-1295) for synergy
  • Each unit dosed at 1 mg — see Recommended Dosage below for protocol-specific intake

Recommended Dosage

Research dosing: 40–60 mcg/day SubQ, split pre-workout and post-workout for training-day protocols. Cycles 4–6 weeks on / 2–4 weeks off to avoid receptor downregulation. Site-inject into target muscles for localised hypertrophy signals.

How It Works

IGF-1 with an Arg→Glu substitution at position 3 plus 13-amino-acid N-terminal extension. The modification reduces IGF-binding-protein affinity, dramatically extending free-IGF-1 exposure in plasma. Binds IGF-1R directly, triggering PI3K/Akt/mTOR anabolic signalling.

Pharmacokinetics

Plasma half-life approximately 20–30 hours — vs native IGF-1’s 10 minutes. Daily SubQ dosing adequate. Reconstituted vial stable in fridge 4–6 weeks. Freeze stock vial for longer storage.

Potential Side Effects

Hypoglycaemia during injection window — eat carbs within 30 minutes. Joint pain on long cycles (carpal tunnel-like). Receptor downregulation with continuous use — cycle on/off matters. Potential cancer-promotion signal on long runs — time-limited use.

Cycle & Stacking Guide

4-week cycles at 40–60 mcg/day pre/post workout. Pair with HGH for axis-level synergy or standalone for muscle-specific effect. Keep carbohydrate-rich snack at hand for hypoglycaemia.

Manufacturer Notes

Bio-Peptide produces research peptides with published HPLC purity data. Lyophilised powder in amber-glass vials; reconstitute with bacteriostatic water before use.

Storage & Handling

Lyophilised (freeze-dried) form: stable at 2–8 °C in the sealed vial for the duration printed on the label. After reconstitution with bacteriostatic water, store reconstituted solution at 2–8 °C and use within 30 days. Do not freeze reconstituted peptide — ice crystals denature the molecule. Keep out of reach of children. For research and educational purposes only.

Reviews

There are no reviews yet.

Be the first to review “Des (1-3) IGF 1 mg Bio-Peptide”

Your email address will not be published. Required fields are marked *

Igf 1 Lr3

Physical & Chemical Properties for Research Purposes
Chemical structure of Igf 1 Lr3 (C400H625N111O115S9) for laboratory analysis
Complex peptide — 2D render unavailable. Reference via SMILES/InChI below.
Chemical Identity
# CAS Registry Number 946870-92-4
Σ IUPAC Name Insulin-like Growth Factor 1 Long R3 (83-amino acid analog of IGF-1 with Arg3 substitution and N-terminal MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPT extension)
F Molecular Formula C400H625N111O115S9
M Molecular Weight 9117.00 g/mol
Melting Point N/A (peptide, lyophilized) °C
Solubility Soluble in dilute acetic acid and bacteriostatic water
Biological Half-life 20-30 hours (SC)
Pharmacological Profile
Aromatization None
Hepatotoxicity None
Known trade names: IGF-1 LR3, Long R3 IGF-1
External references

Data sourced from published pharmacological literature and authoritative chemical databases (PubChem, DrugBank, ChEBI). Provided for identification and research reference only.