Peptide / HGH
Igf 1 Lr3
-
CAS
946870-92-4 - Formula C400H625N111O115S9
- Half-life 20-30 hours (SC)
Chemical Identity
| CAS Number |
946870-92-4 |
|---|---|
| IUPAC Name | Insulin-like Growth Factor 1 Long R3 (83-amino acid analog of IGF-1 with Arg3 substitution and N-terminal MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPT extension) |
| Molecular Formula | C400H625N111O115S9 |
| Molecular Weight | 9117.00 g/mol |
| Melting Point | N/A (peptide, lyophilized) °C |
| Solubility | Soluble in dilute acetic acid and bacteriostatic water |
| Half-life | 20-30 hours (SC) |
Pharmacological Profile
| Aromatisation | None |
|---|---|
| Hepatotoxicity | None |
Known trade names
- IGF-1 LR3
- Long R3 IGF-1
External references
Data sourced from peer-reviewed pharmacological literature and authoritative chemical databases (PubChem, DrugBank, ChEBI). Provided for identification and research reference only — not medical advice.