Peptide / HGH

Igf 1 Lr3

  • CAS 946870-92-4
  • Formula C400H625N111O115S9
  • Half-life 20-30 hours (SC)
Chemical structure of Igf 1 Lr3

Chemical Identity

CAS Number 946870-92-4
IUPAC Name Insulin-like Growth Factor 1 Long R3 (83-amino acid analog of IGF-1 with Arg3 substitution and N-terminal MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPT extension)
Molecular Formula C400H625N111O115S9
Molecular Weight 9117.00 g/mol
Melting Point N/A (peptide, lyophilized) °C
Solubility Soluble in dilute acetic acid and bacteriostatic water
Half-life 20-30 hours (SC)

Pharmacological Profile

Aromatisation None
Hepatotoxicity None

Known trade names

  • IGF-1 LR3
  • Long R3 IGF-1

External references

Data sourced from peer-reviewed pharmacological literature and authoritative chemical databases (PubChem, DrugBank, ChEBI). Provided for identification and research reference only — not medical advice.